HPA002044

PSMC4 antibody from Sigma-Aldrich
MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002044
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002044, RRID:AB_1079707
Product name
Anti-PSMC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002044
Antibody type
Polyclonal
Antigen
26S protease regulatory subunit 6B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKE
FLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGST
TGSNYYVRILSTIDRELLKPNASVALHKHSNA
Storage
-20C
Provider Type Product Number
- No reagents -