HPA003341

CNTN3 antibody from Sigma-Aldrich
BIG-1, PANG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003341
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003341, RRID:AB_1078556
Product name
Anti-CNTN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003341
Antibody type
Polyclonal
Antigen
Contactin-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASA
PDFSKNPMKKLVQVQVGSLVSLDCKPRASPRALSS
WKKGDVSVQEHERISLLNDGGLKIANVTKADAGTY
TCMAENQFGKANGTTHLVVTEPTRI
Storage
-20C
Provider Type Product Number
- No reagents -