HPA018458

XIRP1 antibody from MilliporeSigma / Merck KGaA
CMYA1, DKFZp451D042, Xin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018458
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018458, RRID:AB_1858885
Product name
Anti-XIRP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018458
Antibody type
Polyclonal
Antigen
Xin actin-binding repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVSTEVAQLKEQTLARLLDIEEAVHKALSSMSSLQ
PEASARGHFQGPPKDHSAHKISVTVSSSARPSGSG
QEVGGQTAVKNQAKVECHTEAQSQVKIRNHT
Storage
-20C
Provider Type Product Number
- No reagents -