HPA016750

XIRP1 antibody from Atlas Antibodies
CMYA1, DKFZp451D042, Xin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016750
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016750, RRID:AB_1670205
Product name
Anti-XIRP1
Provider product page
Atlas Antibodies - HPA016750
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSCTWMFKPQPVDRPVGSREQHLQVSQVPAGERQT
DRHVFETEPLQASGRPCGRRPVRYCSRVEIPSGQV
SRQKEVFQALEAGKKEEQEPRVIAGSIPAGSVHKF
T
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -