HPA016754

ACP1 antibody from Sigma-Aldrich
HAAP, LMW-PTP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016754
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016754, RRID:AB_1844505
Product name
Anti-ACP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016754
Antibody type
Polyclonal
Antigen
Low molecular weight phosphotyrosine protein phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMS
HVARQITKEDFATFDYILCMDESNLRDLNRKSNQV
KTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETV
YQ
Storage
-20C
Provider Type Product Number
- No reagents -