HPA016754

ACP1 antibody from Atlas Antibodies
HAAP, LMW-PTP, LMWPTP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016754
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016754, RRID:AB_1844505
Product name
Anti-ACP1
Provider product page
Atlas Antibodies - HPA016754
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMS
HVARQITKEDFATFDYILCMDESNLRDLNRKSNQV
KTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETV
YQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -