HPA009976

ANGPTL1 antibody from Sigma-Aldrich
ANG3, ANGPT3, AngY, ARP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009976
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009976, RRID:AB_1844822
Product name
Anti-ANGPTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009976
Antibody type
Polyclonal
Antigen
Angiopoietin-related protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKMATRYRELEVKYASLTDLVNNQSVMITLLEEQC
LRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLG
GNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVT
FINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPM
QLWCENS
Storage
-20C
Provider Type Product Number
- No reagents -