H00011001-M01

SLC27A2 antibody from Abnova Corporation
ACSVL1, FACVL1, FATP2, hFACVL1, HsT17226, VLACS, VLCS

Antibody data

Product number
H00011001-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011001-M01, RRID:AB_1580688
Product name
SLC27A2 monoclonal antibody (M01), clone 1F1
Provider product page
Abnova Corporation - H00011001-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC27A2.
Antigen sequence
YFFQDIGYFLKVAAVGRRVRSYGQRRPARTILRAF
LEKARQTPHKPFLLFRDETLTYAQVDRRSNQVARA
LHDHLGLRQGDCVALLMGNEPAYVWLWLG
Isotype
IgG
Antibody clone number
1F1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -