HPA004126

LAMTOR2 antibody from Sigma-Aldrich
ENDAP, MAPBPIP, MAPKSP1AP, p14, Ragulator2, ROBLD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004126
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004126, RRID:AB_1849916
Product name
Anti-ROBLD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004126
Antibody type
Polyclonal
Antigen
Mitogen-activated protein-binding protein-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGY
GDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFI
LMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAK
AQALVQYLEEP
Storage
-20C
Provider Type Product Number
- No reagents -