Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004852-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004852-M01, RRID:AB_464372
- Product name
- NPY monoclonal antibody (M01), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NPY.
- Antigen sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQR
YGKRSSPETLISDLLMRESTENVPRTRLEDPAMW- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ontogenic development of nerve fibers in human fetal livers: an immunohistochemical study using neural cell adhesion molecule (NCAM) and neuron-specific enolase (NSE).
Neuropeptide Y influences acute food intake and energy status affects NPY immunoreactivity in the female musk shrew (Suncus murinus).
Terada T
Histochemistry and cell biology 2015 Apr;143(4):421-9
Histochemistry and cell biology 2015 Apr;143(4):421-9
Neuropeptide Y influences acute food intake and energy status affects NPY immunoreactivity in the female musk shrew (Suncus murinus).
Bojkowska K, Hamczyk MM, Tsai HW, Riggan A, Rissman EF
Hormones and behavior 2008 Feb;53(2):342-50
Hormones and behavior 2008 Feb;53(2):342-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NPY expression in transfected 293T cell line by NPY monoclonal antibody (M01), clone 3B5.Lane 1: NPY transfected lysate(10.9 KDa).Lane 2: Non-transfected lysate.