Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA025062 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA025062, RRID:AB_1857220
- Product name
- Anti-SLCO5A1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVR
DLPRAAVRILSNM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate
Organic Anion Transporting Polypeptide 5A1 (OATP5A1) in Small Cell Lung Cancer (SCLC) Cells: Possible Involvement in Chemoresistance to Satraplatin.
Patik I, Kovacsics D, Német O, Gera M, Várady G, Stieger B, Hagenbuch B, Szakács G, Özvegy-Laczka C
Biochemical Pharmacology 2015 December;98(4):649-658
Biochemical Pharmacology 2015 December;98(4):649-658
Organic Anion Transporting Polypeptide 5A1 (OATP5A1) in Small Cell Lung Cancer (SCLC) Cells: Possible Involvement in Chemoresistance to Satraplatin.
Olszewski-Hamilton U, Svoboda M, Thalhammer T, Buxhofer-Ausch V, Geissler K, Hamilton G
Biomarkers in cancer 2011;3:31-40
Biomarkers in cancer 2011;3:31-40
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction centra.
- Sample type
- HUMAN