HPA003742

DYNC1H1 antibody from Atlas Antibodies
CMT2O, DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003742
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003742, RRID:AB_1078713
Product name
Anti-DYNC1H1
Provider product page
Atlas Antibodies - HPA003742
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNL
PIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAE
DKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITN
QVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQS
QR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -