HPA003742

DYNC1H1 antibody from Sigma-Aldrich
CMT2O, DHC1, DNCH1, Dnchc1, DNCL, DNECL, HL-3, p22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003742
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003742, RRID:AB_1078713
Product name
Anti-DYNC1H1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003742
Antibody type
Polyclonal
Antigen
Dynein heavy chain, cytosolic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNL
PIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAE
DKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITN
QVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQS
QR
Storage
-20C
Provider Type Product Number
- No reagents -