HPA003581

TRIM42 antibody from Sigma-Aldrich
FLJ40097, PPP1R40, T4A1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003581
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003581, RRID:AB_1080383
Product name
Anti-TRIM42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003581
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIMEQIENLEVSRQKEIEKYVYVTTMKVNEMDGLI
AYSKEALKETGQVAFLQSAKILVDQIEDGIQTTYR
PDPQLRLHSINYVPLDFVELSSAIHELFPTGPKKV
RSSGDSLPSPYPVHSETMIARKVTFSTHS
Storage
-20C
Provider Type Product Number
- No reagents -