HPA022481

TRIM42 antibody from MilliporeSigma / Merck KGaA
FLJ40097, PPP1R40, T4A1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022481
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA022481, RRID:AB_1858301
Product name
Anti-TRIM42 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA022481
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLNCYYYESRCCRNTIITFHKGRLRSIHTSSKTAL
RTGSSDTQVDEVKSIPANSHLVNHLNCPMCSRLRL
HSFMLPCNHSLCEKCLRQLQKHAEVTENFFILICP
VCDRSHCMPYSNKMQ
Storage
-20C
Provider Type Product Number
- No reagents -