H00030835-M01

CD209 antibody from Abnova Corporation
CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1

Antibody data

Product number
H00030835-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00030835-M01, RRID:AB_1572305
Product name
CD209 monoclonal antibody (M01), clone 3B10
Provider product page
Abnova Corporation - H00030835-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CD209.
Antigen sequence
SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQL
QSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFK
QYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFW
ICKKS
Isotype
IgG
Antibody clone number
3B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -