Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00030835-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00030835-M01, RRID:AB_1572305
- Product name
- CD209 monoclonal antibody (M01), clone 3B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CD209.
- Antigen sequence
SNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQL
QSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFK
QYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFW
ICKKS- Isotype
- IgG
- Antibody clone number
- 3B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CD209 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CD209 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of CD209 transfected lysate using anti-CD209 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CD209 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
