HPA023929

TRAM1 antibody from Atlas Antibodies
TRAM, TRAMP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023929
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023929, RRID:AB_1858239
Product name
Anti-TRAM1
Provider product page
Atlas Antibodies - HPA023929
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVN
GTLTSNVADSPRNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -