HPA023929

TRAM1 antibody from Sigma-Aldrich
TRAM, TRAMP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023929
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023929, RRID:AB_1858239
Product name
Anti-TRAM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023929
Antibody type
Polyclonal
Antigen
Translocation-associated membrane protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRWREHSAFQAPAVKKKPTVTKGRSSKKGTENGVN
GTLTSNVADSPRNK
Storage
-20C
Provider Type Product Number
- No reagents -