H00006291-M08

SAA4 antibody from Abnova Corporation
C-SAA, CSAA

Antibody data

Product number
H00006291-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006291-M08, RRID:AB_1137021
Product name
SAA4 monoclonal antibody (M08), clone 3C11
Provider product page
Abnova Corporation - H00006291-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SAA4.
Antigen sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDM
GRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGV
WAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSN
EKAEEWGRSGKDPDRFRPDGLPKKY
Isotype
IgG
Antibody clone number
3C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -