Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006291-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006291-D01P, RRID:AB_1706775
- Product name
- SAA4 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human SAA4 protein.
- Antigen sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDM
GRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGV
WAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSN
EKAEEWGRSGKDPDRFRPDGLPKKY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
Chen CL, Lin TS, Tsai CH, Wu CC, Chung T, Chien KY, Wu M, Chang YS, Yu JS, Chen YT
Journal of proteomics 2013 Jun 24;85:28-43
Journal of proteomics 2013 Jun 24;85:28-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SAA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SAA4 expression in transfected 293T cell line (H00006291-T02) by SAA4 MaxPab polyclonal antibody.Lane 1: SAA4 transfected lysate(14.80 KDa).Lane 2: Non-transfected lysate.