Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006291-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006291-D01, RRID:AB_10718439
- Product name
- SAA4 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human SAA4 protein.
- Antigen sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDM
GRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGV
WAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSN
EKAEEWGRSGKDPDRFRPDGLPKKY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SAA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SAA4 expression in transfected 293T cell line (H00006291-T02) by SAA4 MaxPab polyclonal antibody.Lane 1: SAA4 transfected lysate(14.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SAA4 transfected lysate using anti-SAA4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SAA4 purified MaxPab mouse polyclonal antibody (B02P) (H00006291-B02P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol