Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000836-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000836-D01P, RRID:AB_1572134
- Product name
- CASP3 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CASP3 protein.
- Antigen sequence
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDN
SYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSK
EDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVAT
EFESFSFDATFHAKKQIPCIVSMLTKELYFYH- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phospho-ΔNp63α is a key regulator of the cisplatin-induced microRNAome in cancer cells.
Huang Y, Chuang A, Hao H, Talbot C, Sen T, Trink B, Sidransky D, Ratovitski E
Cell death and differentiation 2011 Jul;18(7):1220-30
Cell death and differentiation 2011 Jul;18(7):1220-30
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CASP3 expression in transfected 293T cell line (H00000836-T01) by CASP3 MaxPab polyclonal antibody.Lane 1: CASP3 transfected lysate(31.60 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CASP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CASP3 expression in mouse liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to CASP3 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CASP3 and AKT3. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-AKT3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)