HPA002643

CASP3 antibody from Sigma-Aldrich
apopain, CPP32, CPP32B, Yama
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002643
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002643, RRID:AB_1846048
Product name
Anti-CASP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002643
Antibody type
Polyclonal
Antigen
Caspase-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFH
KSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDL
TREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGI
IFGTNGPVDL
Storage
-20C
Provider Type Product Number
- No reagents -