Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006288-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006288-M01, RRID:AB_425668
- Product name
- SAA1 monoclonal antibody (M01), clone 3C11-2C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SAA1.
- Antigen sequence
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDM
WRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV
WAAEAISDARENIQRFFGHGAEDSLADQAADEWGR
SGKDPNHFRPAGLPEKY- Isotype
- IgG
- Antibody clone number
- 3C11-2C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SAA1 monoclonal antibody (M01), clone 3C11-2C1. Western Blot analysis of SAA1 expression in human spleen.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SAA1 is 1 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SAA1 on formalin-fixed paraffin-embedded human colon adenocarcinoma tissue. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol