H00026031-B01P

OSBPL3 antibody from Abnova Corporation
KIAA0704, ORP-3, ORP3, OSBP3

Antibody data

Product number
H00026031-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026031-B01P, RRID:AB_1578307
Product name
OSBPL3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00026031-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OSBPL3 protein.
Antigen sequence
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSW
EVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWH
KRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSV
MSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSK
LRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGV
FDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVP
LWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDV
LHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTL
DFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFT
LRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLK
NALSSENSRDENRALVHQLSNESRLSITDSLSEFF
DAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNL
SNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPS
SSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQ
RLCEELEYSELLDKAAQIPSPLERMVYVAAFAISA
YASSYYRAGSKPFNPVLGETYECIREDKGFQFFSE
QVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSM
EIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQ
RWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNA
HEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSA
CVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSL
LPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQR
ERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLEL
RKDLGFSKLDHPVLW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -