HPA000691

OSBPL3 antibody from Sigma-Aldrich
KIAA0704, ORP-3, ORP3, OSBP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000691, RRID:AB_1854814
Product name
Anti-OSBPL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000691
Antibody type
Polyclonal
Antigen
Oxysterol-binding protein-related protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVY
FTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIG
LKNALSSALAQNTDLKERLRRIHAESLLLDSPAVA
KSGDNLAEE
Storage
-20C
Provider Type Product Number
- No reagents -