HPA023880

PAGE4 antibody from Atlas Antibodies
CT16.7, GAGEC1, PAGE-4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023880
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023880, RRID:AB_1854930
Product name
Anti-PAGE4
Provider product page
Atlas Antibodies - HPA023880
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVV
AFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEER
KVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHA
KTKEAGDGQP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -