HPA023880

PAGE4 antibody from Sigma-Aldrich
CT16.7, GAGEC1, PAGE-4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023880
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023880, RRID:AB_1854930
Product name
Anti-PAGE4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023880
Antibody type
Polyclonal
Antigen
G antigen family C member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSSSSVHDLLVAAMSARVRSRSRGRGDGQEAPDVV
AFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEER
KVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHA
KTKEAGDGQP
Storage
-20C
Provider Type Product Number
- No reagents -