Explore
Validate
LearnAMAb90990
antibody from Atlas Antibodies
Targeting: PDIA3
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90990 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90990, RRID:AB_2665751
- Product name
- Anti-PDIA3
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPA
SVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSE
FLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIIL
FRPSHLTNKFEDK- Epitope
- Binds to an epitope located within the peptide sequence PTLKIFRDGEEAGAY as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2446
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2:Human cell line U-251 MG
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular epithelium and lamina propria cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong cytoplasmic immunoreactivity in glandular epithelium cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic immunoreactivity in the trophoblast.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows absence of immunoreactivity (negative control).
