HPA002645

PDIA3 antibody from Atlas Antibodies
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002645
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002645, RRID:AB_1079031
Product name
Anti-PDIA3
Provider product page
Atlas Antibodies - HPA002645
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFG
LESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE
RFLQDYFDGNLKRYLKSEPIPESNDGP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -