HPA003230

PDIA3 antibody from Atlas Antibodies
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003230
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003230, RRID:AB_1079030
Product name
Anti-PDIA3
Provider product page
Atlas Antibodies - HPA003230
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPA
SVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSE
FLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIIL
FRPSHLTNKFEDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -