HPA002645

PDIA3 antibody from Sigma-Aldrich
ERp57, ERp60, ERp61, GRP57, GRP58, HsT17083, P58, PI-PLC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002645
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002645, RRID:AB_1079031
Product name
Anti-PDIA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002645
Antibody type
Polyclonal
Antigen
Protein disulfide-isomerase A3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFG
LESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE
RFLQDYFDGNLKRYLKSEPIPESNDGP
Storage
-20C
Provider Type Product Number
- No reagents -