ABIN502839

KRT19 antibody from antibodies-online
CK19, K19, K1CS, MGC15366

Antibody data

Product number
ABIN502839
Provider
antibodies-online
Product name
anti-Keratin 19 (KRT19) (N-Term) antibody
Provider product page
antibodies-online - ABIN502839
Antibody type
Polyclonal
Antigen
The immunogen for anti-KRT19 antibody: synthetic peptide directed towards the N terminal of human KRT19
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKIL
GATIE NSRIVLQIDN
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -