Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502839 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Keratin 19 (KRT19) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KRT19 antibody: synthetic peptide directed towards the N terminal of human KRT19
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKIL
GATIE NSRIVLQIDN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A simple two-gene prognostic model for adenocarcinoma of the lung.
Reed CE, Graham A, Hoda RS, Khoor A, Garrett-Mayer E, Wallace MB, Mitas M
The Journal of thoracic and cardiovascular surgery 2008 Mar;135(3):627-34
The Journal of thoracic and cardiovascular surgery 2008 Mar;135(3):627-34
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting