HPA003602

ANKLE2 antibody from Sigma-Aldrich
KIAA0692, Lem4, LEMD7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003602
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003602, RRID:AB_1858349
Product name
Anti-ANKLE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003602
Antibody type
Polyclonal
Antigen
Ankyrin repeat and LEM domain-containing protein 2
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDT
FSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAA
KENQASICQLTLDVLENPDFMRLMYPDDDEAMLQK
RIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVN
VLSSH
Storage
-20C
Provider Type Product Number
- No reagents -