HPA003584

PARP12 antibody from Atlas Antibodies
FLJ22693, PARP-12, ZC3H1, ZC3HDC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003584
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003584, RRID:AB_1079568
Product name
Anti-PARP12
Provider product page
Atlas Antibodies - HPA003584
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCR
RPKYVSPQDVTTMQTCNTKFPGPKSIPDYWDSSAL
PDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQK
IERVQNLALWEVYQWQKGQMQKQNGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -