HPA003584

PARP12 antibody from Sigma-Aldrich
FLJ22693, PARP-12, ZC3H1, ZC3HDC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003584
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003584, RRID:AB_1079568
Product name
Anti-PARP12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003584
Antibody type
Polyclonal
Antigen
Poly(ADP-ribose) polymerase 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCR
RPKYVSPQDVTTMQTCNTKFPGPKSIPDYWDSSAL
PDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQK
IERVQNLALWEVYQWQKGQMQKQNGG
Storage
-20C
Provider Type Product Number
- No reagents -