HPA021632

CYB5D1 antibody from MilliporeSigma / Merck KGaA
FLJ32499
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021632
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021632, RRID:AB_1847368
Product name
Anti-CYB5D1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021632
Antibody type
Polyclonal
Antigen
Cytochrome b5 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLL
KPIVEVAGQDISHWFDPKTRDIRKHIDPLT
Storage
-20C
Provider Type Product Number
- No reagents -