Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029089-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029089-M01, RRID:AB_425950
- Product name
- UBE2T monoclonal antibody (M01), clone 1E12-4A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant UBE2T.
- Antigen sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLR
AQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIA
TVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVH
NSTQKRKASQLVGIEKKFHPDV- Isotype
- IgG
- Antibody clone number
- 1E12-4A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.
Ramaekers CH, van den Beucken T, Meng A, Kassam S, Thoms J, Bristow RG, Wouters BG
Radiotherapy and oncology : journal of the European Society for Therapeutic Radiology and Oncology 2011 Oct;101(1):190-7
Radiotherapy and oncology : journal of the European Society for Therapeutic Radiology and Oncology 2011 Oct;101(1):190-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBE2T monoclonal antibody (M01), clone 1E12-4A3 Western Blot analysis of UBE2T expression in Hela ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol