Antibody data

Product number
H00029089-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029089-M02, RRID:AB_1205155
Product name
UBE2T monoclonal antibody (M02), clone 4G1-4C2
Provider product page
Abnova Corporation - H00029089-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UBE2T.
Antigen sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLR
AQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIA
TVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVH
NSTQKRKASQLVGIEKKFHPDV
Isotype
IgG
Antibody clone number
4G1-4C2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -