Antibody data

Product number
H00029089-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029089-M03, RRID:AB_1581662
Product name
UBE2T monoclonal antibody (M03), clone 2A12-4F11
Provider product page
Abnova Corporation - H00029089-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UBE2T.
Antigen sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLR
AQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIA
TVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVH
NSTQKRKASQLVGIEKKFHPDV
Isotype
IgG
Antibody clone number
2A12-4F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -