HPA031452

ZNF620 antibody from MilliporeSigma / Merck KGaA
MGC50836
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031452
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031452, RRID:AB_10603939
Product name
Anti-ZNF620 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031452
Antibody type
Polyclonal
Antigen
zinc finger protein 620 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSKRRHFTDTSARHHEAYEVKNGEKFEKLGKNISV
STQLTTNQTNPSGQISYECGQCGRYFIQMADFHRH
EKCHTGEKSFECKECGKYFRYNS
Storage
-20C
Provider Type Product Number
- No reagents -