HPA005487

TPX2 antibody from Atlas Antibodies
C20orf1, C20orf2, DIL-2, p100
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005487
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005487, RRID:AB_1858223
Product name
Anti-TPX2
Provider product page
Atlas Antibodies - HPA005487
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPV
KKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVN
FTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTF
DETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -