HPA005487

TPX2 antibody from Sigma-Aldrich
C20orf1, C20orf2, DIL-2, p100
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005487
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005487, RRID:AB_1858223
Product name
Anti-TPX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005487
Antibody type
Polyclonal
Antigen
Targeting protein for Xklp2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPV
KKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVN
FTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTF
DETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Storage
-20C
Provider Type Product Number
- No reagents -