HPA020466

LRRC8E antibody from Sigma-Aldrich
FLJ23420
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020466
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020466, RRID:AB_1853352
Product name
Anti-LRRC8E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020466
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 8E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLRQKLQRNAAGRLELALCMLPGLPDTVFELSEVE
SLRLEAICDITFPPGLSQLVHLQELSLLHSPARLP
FSLQVFLRDHLKVMRVKCEELREVPLWVFGLRGLE
ELHLEGLFPQELARAATL
Storage
-20C
Provider Type Product Number
- No reagents -