Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184351 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Small Nuclear RNA Activating Complex, Polypeptide 2, 45kDa (SNAPC2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESA
VVLDL LMSLPEELPL- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
A physical and transcript map of the MCOLN1 gene region on human chromosome 19p13.3-p13.2.
Hinkley CS, Hirsch HA, Gu L, LaMere B, Henry RW
The Journal of biological chemistry 2003 May 16;278(20):18649-57
The Journal of biological chemistry 2003 May 16;278(20):18649-57
A physical and transcript map of the MCOLN1 gene region on human chromosome 19p13.3-p13.2.
Acierno JS Jr, Kennedy JC, Falardeau JL, Leyne M, Bromley MC, Colman MW, Sun M, Bove C, Ashworth LK, Chadwick LH, Schiripo T, Ma S, Goldin E, Schiffmann R, Slaugenhaupt SA
Genomics 2001 Apr 15;73(2):203-10
Genomics 2001 Apr 15;73(2):203-10
No comments: Submit comment
No validations: Submit validation data