PAB20145

PIK3IP1 antibody from Abnova Corporation
HGFL, MGC17330, TrIP
Western blot
Recommended by provider
Immunohistochemistry
Supportive data in Antibodypedia

Antibody data

Product number
PAB20145
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20145, RRID:AB_10964462
Product name
PIK3IP1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20145
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human PIK3IP1.
Reactivity
Human
Host
Rabbit
Antigen sequence
GCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLAS
APVSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEK
RPCEDLRCPETTSQALPAFTTEIQEASEGPGADEV
QVFAPANALPARSEAAAVQPVIGISQRVRMNSKEK
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -