HPA002959

PIK3IP1 antibody from Sigma-Aldrich
HGFL, MGC17330
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002959, RRID:AB_1079370
Product name
Anti-PIK3IP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002959
Antibody type
Polyclonal
Antigen
Kringle domain-containing protein HGFL precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLAS
APVSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEK
RPCEDLRCPETTSQALPAFTTEIQEASEGPGADEV
QVFAPANALPARSEAAAVQPVIGISQRVRMNSKEK
Storage
-20C
Provider Type Product Number
- No reagents -