HPA002906

EXD2 antibody from Atlas Antibodies
C14orf114, EXDL2, FLJ10738
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002906
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002906, RRID:AB_1078767
Product name
Anti-EXD2
Provider product page
Atlas Antibodies - HPA002906
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRS
SWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFP
VLGIDCEWERHGTYLQWLF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -