HPA002906

EXD2 antibody from Sigma-Aldrich
C14orf114, EXDL2, FLJ10738
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002906
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002906, RRID:AB_1078767
Product name
Anti-EXDL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002906
Antibody type
Polyclonal
Antigen
Exonuclease 3'-5' domain-like-containing protein 2
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRS
SWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFP
VLGIDCEWERHGTYLQWLF
Storage
-20C
Provider Type Product Number
- No reagents -