HPA007354

MFAP2 antibody from Atlas Antibodies
MAGP, MAGP-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007354
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007354, RRID:AB_1079365
Product name
Anti-MFAP2
Provider product page
Atlas Antibodies - HPA007354
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQ
QVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYP
CTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICV
RTVCAHEELLRADLCRDKFSKCG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -